Anti SHCBP1L pAb (ATL-HPA036124 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036124-25

Protein Description: SHC SH2-domain binding protein 1-like
Gene Name: SHCBP1L
Alternative Gene Name: C1orf14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042708: 76%, ENSRNOG00000002691: 79%
Entrez Gene ID: 81626
Uniprot ID: Q9BZQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPF
• Gene Sequence: CVSRMRGMWRDEKVSLYCDEVLQDCKAEDADEVMGKYLSEKLKLKDKWLGVWKTNPSVFFVKYEEASIPFVGILVEVTCEPYQDSSSRFKVTVSVAEPF
• Gene ID - Mouse: ENSMUSG00000042708
• Gene ID - Rat: ENSRNOG00000002691
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SHCBP1L pAb (ATL-HPA036124 w/enhanced validation) – 1 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.