Anti SH3YL1 pAb (ATL-HPA030926)

Atlas Antibodies

Catalog No.:
ATL-HPA030926-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SH3 and SYLF domain containing 1
Gene Name: SH3YL1
Alternative Gene Name: DKFZP586F1318, Ray
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020669: 93%, ENSRNOG00000005522: 93%
Entrez Gene ID: 26751
Uniprot ID: Q96HL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG
Gene Sequence FTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEG
Gene ID - Mouse ENSMUSG00000020669
Gene ID - Rat ENSRNOG00000005522
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SH3YL1 pAb (ATL-HPA030926)
Datasheet Anti SH3YL1 pAb (ATL-HPA030926) Datasheet (External Link)
Vendor Page Anti SH3YL1 pAb (ATL-HPA030926) at Atlas Antibodies

Documents & Links for Anti SH3YL1 pAb (ATL-HPA030926)
Datasheet Anti SH3YL1 pAb (ATL-HPA030926) Datasheet (External Link)
Vendor Page Anti SH3YL1 pAb (ATL-HPA030926)