Anti SH3GL3 pAb (ATL-HPA039381 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039381-25

Protein Description: SH3-domain GRB2-like 3
Gene Name: SH3GL3
Alternative Gene Name: CNSA3, EEN-B2, HsT19371, SH3D2C, SH3P13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030638: 75%, ENSRNOG00000019776: 75%
Entrez Gene ID: 6457
Uniprot ID: Q99963
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQP
• Gene Sequence: KELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTGSNIPMDQP
• Gene ID - Mouse: ENSMUSG00000030638
• Gene ID - Rat: ENSRNOG00000019776
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SH3GL3 pAb (ATL-HPA039381 w/enhanced validation) – 1 Found

Renard, Henri-François; Tyckaert, François; Lo Giudice, Cristina; Hirsch, Thibault; Valades-Cruz, Cesar Augusto; Lemaigre, Camille; Shafaq-Zadah, Massiullah; Wunder, Christian; Wattiez, Ruddy; Johannes, Ludger; van der Bruggen, Pierre; Alsteens, David; Morsomme, Pierre. Endophilin-A3 and Galectin-8 control the clathrin-independent endocytosis of CD166. Nature Communications. 2020;11(1):1457.