Anti SH3GL1 pAb (ATL-HPA021485)

Atlas Antibodies

Catalog No.: ATL-HPA021485-25

Protein Description: SH3-domain GRB2-like 1
Gene Name: SH3GL1
Alternative Gene Name: CNSA1, EEN, MGC111371, SH3D2B, SH3P8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003200: 87%, ENSRNOG00000049683: 85%
Entrez Gene ID: 6455
Uniprot ID: Q99961
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHE
• Gene Sequence: VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHE
• Gene ID - Mouse: ENSMUSG00000003200
• Gene ID - Rat: ENSRNOG00000049683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SH3GL1 pAb (ATL-HPA021485) – 1 Found

Norin, Ulrika; Rintisch, Carola; Meng, Liesu; Forster, Florian; Ekman, Diana; Tuncel, Jonatan; Klocke, Katrin; Bäcklund, Johan; Yang, Min; Bonner, Michael Y; Lahore, Gonzalo Fernandez; James, Jaime; Shchetynsky, Klementy; Bergquist, Maria; Gjertsson, Inger; Hubner, Norbert; Bäckdahl, Liselotte; Holmdahl, Rikard. Endophilin A2 deficiency protects rodents from autoimmune arthritis by modulating T cell activation. Nature Communications. 2021;12(1):610.