Anti SH3BP2 pAb (ATL-HPA036790)

Atlas Antibodies

Catalog No.: ATL-HPA036790-100

Protein Description: SH3-domain binding protein 2
Gene Name: SH3BP2
Alternative Gene Name: CRBM, RES4-23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054520: 97%, ENSRNOG00000013747: 95%
Entrez Gene ID: 6452
Uniprot ID: P78314
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY
• Gene Sequence: LPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHY
• Gene ID - Mouse: ENSMUSG00000054520
• Gene ID - Rat: ENSRNOG00000013747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.