Anti SH2D3A pAb (ATL-HPA035722)

Atlas Antibodies

Catalog No.: ATL-HPA035722-100

Protein Description: SH2 domain containing 3A
Gene Name: SH2D3A
Alternative Gene Name: NSP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015850: 29%, ENSRNOG00000030266: 31%
Entrez Gene ID: 10045
Uniprot ID: Q9BRG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IEPLRARKWSNSQPADLAHMGRSREDPAGMEASTMPISALPRTSSDPVLLKAPAPLGTVADSLRASDGQLQAKAPTKPPRTPSFELPDASERP
• Gene Sequence: IEPLRARKWSNSQPADLAHMGRSREDPAGMEASTMPISALPRTSSDPVLLKAPAPLGTVADSLRASDGQLQAKAPTKPPRTPSFELPDASERP
• Gene ID - Mouse: ENSMUSG00000015850
• Gene ID - Rat: ENSRNOG00000030266
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SH2D3A pAb (ATL-HPA035722) – 1 Found

Danielsson, Frida; Wiking, Mikaela; Mahdessian, Diana; Skogs, Marie; Ait Blal, Hammou; Hjelmare, Martin; Stadler, Charlotte; Uhlén, Mathias; Lundberg, Emma. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. Journal Of Proteome Research. 2013;12(1):299-307.