Anti SGTB pAb (ATL-HPA044689)

Atlas Antibodies

Catalog No.: ATL-HPA044689-100

Protein Description: small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
Gene Name: SGTB
Alternative Gene Name: FLJ39002, Sgt2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042743: 92%, ENSRNOG00000011937: 92%
Entrez Gene ID: 54557
Uniprot ID: Q96EQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHM
• Gene Sequence: KISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHM
• Gene ID - Mouse: ENSMUSG00000042743
• Gene ID - Rat: ENSRNOG00000011937
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.