Anti SGTB pAb (ATL-HPA044689)

Atlas Antibodies

Catalog No.:
ATL-HPA044689-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: small glutamine-rich tetratricopeptide repeat (TPR)-containing, beta
Gene Name: SGTB
Alternative Gene Name: FLJ39002, Sgt2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042743: 92%, ENSRNOG00000011937: 92%
Entrez Gene ID: 54557
Uniprot ID: Q96EQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHM
Gene Sequence KISPEDTHLAVSQPLTEMFTSSFCKNDVLPLSNSVPEDVGKADQLKDEGNNHM
Gene ID - Mouse ENSMUSG00000042743
Gene ID - Rat ENSRNOG00000011937
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SGTB pAb (ATL-HPA044689)
Datasheet Anti SGTB pAb (ATL-HPA044689) Datasheet (External Link)
Vendor Page Anti SGTB pAb (ATL-HPA044689) at Atlas Antibodies

Documents & Links for Anti SGTB pAb (ATL-HPA044689)
Datasheet Anti SGTB pAb (ATL-HPA044689) Datasheet (External Link)
Vendor Page Anti SGTB pAb (ATL-HPA044689)