Anti SGCB pAb (ATL-HPA011422 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011422-25

Protein Description: sarcoglycan, beta (43kDa dystrophin-associated glycoprotein)
Gene Name: SGCB
Alternative Gene Name: A3b, LGMD2E, SGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029156: 90%, ENSRNOG00000002135: 88%
Entrez Gene ID: 6443
Uniprot ID: Q16585
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
• Gene Sequence: FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQVTSQNMGCQISDNPCGNTH
• Gene ID - Mouse: ENSMUSG00000029156
• Gene ID - Rat: ENSRNOG00000002135
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SGCB pAb (ATL-HPA011422 w/enhanced validation) – 1 Found

Henriques, Sara F; Patissier, Cécile; Bourg, Nathalie; Fecchio, Chiara; Sandona, Doriana; Marsolier, Justine; Richard, Isabelle. Different outcome of sarcoglycan missense mutation between human and mouse. Plos One. 13(1):e0191274.