Anti SFXN4 pAb (ATL-HPA020872)

Atlas Antibodies

Catalog No.: ATL-HPA020872-25

Protein Description: sideroflexin 4
Gene Name: SFXN4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063698: 60%, ENSRNOG00000036572: 63%
Entrez Gene ID: 119559
Uniprot ID: Q6P4A7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGHSRIAGTKAVRET
• Gene Sequence: KYGLTGPWIKRLLPVIFLVQASGMNVYMSRSLESIKGIAVMDKEGNVLGHSRIAGTKAVRET
• Gene ID - Mouse: ENSMUSG00000063698
• Gene ID - Rat: ENSRNOG00000036572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SFXN4 pAb (ATL-HPA020872) – 1 Found

Tesfay, Lia; Paul, Bibbin T; Hegde, Poornima; Brewer, Molly; Habbani, Samrin; Jellison, Evan; Moore, Timothy; Wu, Hao; Torti, Suzy V; Torti, Frank M. Complementary anti-cancer pathways triggered by inhibition of sideroflexin 4 in ovarian cancer. Scientific Reports. 2022;12(1):19936.