Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA010928-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: surfactant protein C
Gene Name: SFTPC
Alternative Gene Name: BRICD6, PSP-C, SFTP2, SMDP2, SP-C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022097: 75%, ENSRNOG00000011177: 76%
Entrez Gene ID: 6440
Uniprot ID: P11686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
Gene Sequence PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG
Gene ID - Mouse ENSMUSG00000022097
Gene ID - Rat ENSRNOG00000011177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation)
Datasheet Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation)
Datasheet Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation)
Citations for Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) – 2 Found
Strunz, Maximilian; Simon, Lukas M; Ansari, Meshal; Kathiriya, Jaymin J; Angelidis, Ilias; Mayr, Christoph H; Tsidiridis, George; Lange, Marius; Mattner, Laura F; Yee, Min; Ogar, Paulina; Sengupta, Arunima; Kukhtevich, Igor; Schneider, Robert; Zhao, Zhongming; Voss, Carola; Stoeger, Tobias; Neumann, Jens H L; Hilgendorff, Anne; Behr, Jürgen; O'Reilly, Michael; Lehmann, Mareike; Burgstaller, Gerald; Königshoff, Melanie; Chapman, Harold A; Theis, Fabian J; Schiller, Herbert B. Alveolar regeneration through a Krt8+ transitional stem cell state that persists in human lung fibrosis. Nature Communications. 2020;11(1):3559.  PubMed
Mayr, Christoph H; Simon, Lukas M; Leuschner, Gabriela; Ansari, Meshal; Schniering, Janine; Geyer, Philipp E; Angelidis, Ilias; Strunz, Maximilian; Singh, Pawandeep; Kneidinger, Nikolaus; Reichenberger, Frank; Silbernagel, Edith; Böhm, Stephan; Adler, Heiko; Lindner, Michael; Maurer, Britta; Hilgendorff, Anne; Prasse, Antje; Behr, Jürgen; Mann, Matthias; Eickelberg, Oliver; Theis, Fabian J; Schiller, Herbert B. Integrative analysis of cell state changes in lung fibrosis with peripheral protein biomarkers. Embo Molecular Medicine. 2021;13(4):e12871.  PubMed