Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010928-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SFTPC
Alternative Gene Name: BRICD6, PSP-C, SFTP2, SMDP2, SP-C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022097: 75%, ENSRNOG00000011177: 76%
Entrez Gene ID: 6440
Uniprot ID: P11686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG |
| Gene Sequence | PEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVSTLCG |
| Gene ID - Mouse | ENSMUSG00000022097 |
| Gene ID - Rat | ENSRNOG00000011177 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) | |
| Datasheet | Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) | |
| Datasheet | Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) |
| Citations for Anti SFTPC pAb (ATL-HPA010928 w/enhanced validation) – 2 Found |
| Strunz, Maximilian; Simon, Lukas M; Ansari, Meshal; Kathiriya, Jaymin J; Angelidis, Ilias; Mayr, Christoph H; Tsidiridis, George; Lange, Marius; Mattner, Laura F; Yee, Min; Ogar, Paulina; Sengupta, Arunima; Kukhtevich, Igor; Schneider, Robert; Zhao, Zhongming; Voss, Carola; Stoeger, Tobias; Neumann, Jens H L; Hilgendorff, Anne; Behr, Jürgen; O'Reilly, Michael; Lehmann, Mareike; Burgstaller, Gerald; Königshoff, Melanie; Chapman, Harold A; Theis, Fabian J; Schiller, Herbert B. Alveolar regeneration through a Krt8+ transitional stem cell state that persists in human lung fibrosis. Nature Communications. 2020;11(1):3559. PubMed |
| Mayr, Christoph H; Simon, Lukas M; Leuschner, Gabriela; Ansari, Meshal; Schniering, Janine; Geyer, Philipp E; Angelidis, Ilias; Strunz, Maximilian; Singh, Pawandeep; Kneidinger, Nikolaus; Reichenberger, Frank; Silbernagel, Edith; Böhm, Stephan; Adler, Heiko; Lindner, Michael; Maurer, Britta; Hilgendorff, Anne; Prasse, Antje; Behr, Jürgen; Mann, Matthias; Eickelberg, Oliver; Theis, Fabian J; Schiller, Herbert B. Integrative analysis of cell state changes in lung fibrosis with peripheral protein biomarkers. Embo Molecular Medicine. 2021;13(4):e12871. PubMed |