Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042207-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SFT2 domain containing 2
Gene Name: SFT2D2
Alternative Gene Name: dJ747L4.C1.2, UNQ512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040848: 97%, ENSRNOG00000003038: 88%
Entrez Gene ID: 375035
Uniprot ID: O95562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR
Gene Sequence MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR
Gene ID - Mouse ENSMUSG00000040848
Gene ID - Rat ENSRNOG00000003038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation)
Datasheet Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation)
Datasheet Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation)