Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042207-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SFT2D2
Alternative Gene Name: dJ747L4.C1.2, UNQ512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040848: 97%, ENSRNOG00000003038: 88%
Entrez Gene ID: 375035
Uniprot ID: O95562
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR |
| Gene Sequence | MDKLKKVLSGQDTEDRSGLSEVVEASSLSWSTR |
| Gene ID - Mouse | ENSMUSG00000040848 |
| Gene ID - Rat | ENSRNOG00000003038 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) | |
| Datasheet | Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) | |
| Datasheet | Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SFT2D2 pAb (ATL-HPA042207 w/enhanced validation) |