Anti SF3B6 pAb (ATL-HPA034829 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034829-100

Protein Description: splicing factor 3b, subunit 6, 14kDa
Gene Name: SF3B6
Alternative Gene Name: CGI-110, Ht006, P14, SAP14a, SF3B14a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037361: 100%, ENSRNOG00000046172: 70%
Entrez Gene ID: 51639
Uniprot ID: Q9Y3B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP
• Gene Sequence: YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP
• Gene ID - Mouse: ENSMUSG00000037361
• Gene ID - Rat: ENSRNOG00000046172
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.