Anti SF3B3 pAb (ATL-HPA041134)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041134-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SF3B3
Alternative Gene Name: KIAA0017, RSE1, SAP130, SF3b130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033732: 100%, ENSRNOG00000017724: 100%
Entrez Gene ID: 23450
Uniprot ID: Q15393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNS |
| Gene Sequence | ETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNS |
| Gene ID - Mouse | ENSMUSG00000033732 |
| Gene ID - Rat | ENSRNOG00000017724 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SF3B3 pAb (ATL-HPA041134) | |
| Datasheet | Anti SF3B3 pAb (ATL-HPA041134) Datasheet (External Link) |
| Vendor Page | Anti SF3B3 pAb (ATL-HPA041134) at Atlas Antibodies |
| Documents & Links for Anti SF3B3 pAb (ATL-HPA041134) | |
| Datasheet | Anti SF3B3 pAb (ATL-HPA041134) Datasheet (External Link) |
| Vendor Page | Anti SF3B3 pAb (ATL-HPA041134) |