Anti SF3B3 pAb (ATL-HPA041134)

Atlas Antibodies

Catalog No.: ATL-HPA041134-25

Protein Description: splicing factor 3b, subunit 3, 130kDa
Gene Name: SF3B3
Alternative Gene Name: KIAA0017, RSE1, SAP130, SF3b130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033732: 100%, ENSRNOG00000017724: 100%
Entrez Gene ID: 23450
Uniprot ID: Q15393
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNS
• Gene Sequence: ETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNS
• Gene ID - Mouse: ENSMUSG00000033732
• Gene ID - Rat: ENSRNOG00000017724
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.