Anti SETD2 pAb (ATL-HPA042451)

Atlas Antibodies

Catalog No.: ATL-HPA042451-25

Protein Description: SET domain containing 2
Gene Name: SETD2
Alternative Gene Name: FLJ23184, HIF-1, HYPB, KIAA1732, KMT3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044791: 94%, ENSRNOG00000020915: 92%
Entrez Gene ID: 29072
Uniprot ID: Q9BYW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
• Gene Sequence: NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
• Gene ID - Mouse: ENSMUSG00000044791
• Gene ID - Rat: ENSRNOG00000020915
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SETD2 pAb (ATL-HPA042451) – 10 Found

Hacker, Kathryn E; Fahey, Catherine C; Shinsky, Stephen A; Chiang, Yun-Chen J; DiFiore, Julia V; Jha, Deepak Kumar; Vo, Andy H; Shavit, Jordan A; Davis, Ian J; Strahl, Brian D; Rathmell, W Kimryn. Structure/Function Analysis of Recurrent Mutations in SETD2 Protein Reveals a Critical and Conserved Role for a SET Domain Residue in Maintaining Protein Stability and Histone H3 Lys-36 Trimethylation. The Journal Of Biological Chemistry. 2016;291(40):21283-21295. 

Park, In Young; Chowdhury, Pratim; Tripathi, Durga Nand; Powell, Reid T; Dere, Ruhee; Terzo, Esteban A; Rathmell, W Kimryn; Walker, Cheryl Lyn. Methylated α-tubulin antibodies recognize a new microtubule modification on mitotic microtubules. Mabs. 2016;8(8):1590-1597. 

Chiang, Yun-Chen; Park, In-Young; Terzo, Esteban A; Tripathi, Durga Nand; Mason, Frank M; Fahey, Catherine C; Karki, Menuka; Shuster, Charles B; Sohn, Bo-Hwa; Chowdhury, Pratim; Powell, Reid T; Ohi, Ryoma; Tsai, Yihsuan S; de Cubas, Aguirre A; Khan, Abid; Davis, Ian J; Strahl, Brian D; Parker, Joel S; Dere, Ruhee; Walker, Cheryl L; Rathmell, W Kimryn. SETD2 Haploinsufficiency for Microtubule Methylation Is an Early Driver of Genomic Instability in Renal Cell Carcinoma. Cancer Research. 2018;78(12):3135-3146. 

Terzo, Esteban A; Lim, Aaron R; Chytil, Anna; Chiang, Yun Chen; Farmer, Leah; Gessner, Kathryn H; Walker, Cheryl Lyn; Jansen, Valerie M; Rathmell, W Kimryn. SETD2 loss sensitizes cells to PI3Kβ and AKT inhibition. Oncotarget. 2019;10(6):647-659. 

Kanu, N; Grönroos, E; Martinez, P; Burrell, R A; Yi Goh, X; Bartkova, J; Maya-Mendoza, A; Mistrík, M; Rowan, A J; Patel, H; Rabinowitz, A; East, P; Wilson, G; Santos, C R; McGranahan, N; Gulati, S; Gerlinger, M; Birkbak, N J; Joshi, T; Alexandrov, L B; Stratton, M R; Powles, T; Matthews, N; Bates, P A; Stewart, A; Szallasi, Z; Larkin, J; Bartek, J; Swanton, C. SETD2 loss-of-function promotes renal cancer branched evolution through replication stress and impaired DNA repair. Oncogene. 2015;34(46):5699-708. 

Roberti, Annalisa; Dobay, Maria Pamela; Bisig, Bettina; Vallois, David; Boéchat, Cloé; Lanitis, Evripidis; Bouchindhomme, Brigitte; Parrens, Marie-Cécile; Bossard, Céline; Quintanilla-Martinez, Leticia; Missiaglia, Edoardo; Gaulard, Philippe; de Leval, Laurence. Type II enteropathy-associated T-cell lymphoma features a unique genomic profile with highly recurrent SETD2 alterations. Nature Communications. 2016;7( 27600764):12602. 

Martinelli, G; Mancini, M; De Benedittis, C; Rondoni, M; Papayannidis, C; Manfrini, M; Meggendorfer, M; Calogero, R; Guadagnuolo, V; Fontana, M C; Bavaro, L; Padella, A; Zago, E; Pagano, L; Zanotti, R; Scaffidi, L; Specchia, G; Albano, F; Merante, S; Elena, C; Savini, P; Gangemi, D; Tosi, P; Ciceri, F; Poletti, G; Riccioni, L; Morigi, F; Delledonne, M; Haferlach, T; Cavo, M; Valent, P; Soverini, S. SETD2 and histone H3 lysine 36 methylation deficiency in advanced systemic mastocytosis. Leukemia. 2018;32(1):139-148. 

Li, Jiaming; Peng, Zhenping; Luo, Fangxiu; Chen, Yu. SET Domain Containing 2 Deficiency in Myelodysplastic Syndrome. Frontiers In Genetics. 11( 32849799):794. 

Hapke, Robert; Venton, Lindsay; Rose, Kristie Lindsay; Sheng, Quanhu; Reddy, Anupama; Prather, Rebecca; Jones, Angela; Rathmell, W Kimryn; Haake, Scott M. SETD2 regulates the methylation of translation elongation factor eEF1A1 in clear cell renal cell carcinoma. Kidney Cancer Journal : Official Journal Of The Kidney Cancer Association. 6(3):179-193. 

Xie, Yuchen; Sahin, Merve; Sinha, Sonali; Wang, Yufeng; Nargund, Amrita M; Lyu, Yang; Han, Song; Dong, Yiyu; Hsieh, James J; Leslie, Christina S; Cheng, Emily H. SETD2 loss perturbs the kidney cancer epigenetic landscape to promote metastasis and engenders actionable dependencies on histone chaperone complexes. Nature Cancer. 2022;3(2):188-202.