Anti SERTAD4 pAb (ATL-HPA027344)

Atlas Antibodies

Catalog No.: ATL-HPA027344-25

Protein Description: SERTA domain containing 4
Gene Name: SERTAD4
Alternative Gene Name: DJ667H12.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016262: 71%, ENSRNOG00000060773: 70%
Entrez Gene ID: 56256
Uniprot ID: Q9NUC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKLNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCSKGSK
• Gene Sequence: AKLNDEKANDDTNRDGGPLSHEPVGNDLAFECKGQFYDYFETGYNERNNVNESWKKSLRKKEASPPSNKLCCSKGSK
• Gene ID - Mouse: ENSMUSG00000016262
• Gene ID - Rat: ENSRNOG00000060773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.