Anti SERPINF2 pAb (ATL-HPA001885)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001885-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SERPINF2
Alternative Gene Name: A2AP, AAP, ALPHA-2-PI, API, PLI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038224: 80%, ENSRNOG00000003233: 77%
Entrez Gene ID: 5345
Uniprot ID: P08697
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTL |
| Gene Sequence | VPVEMMQARTYPLRWFLLEQPEIQVAHFPFKNNMSFVVLVPTHFEWNVSQVLANLSWDTLHPPLVWERPTKVRLPKLYLKHQMDLVATLSQLGLQELFQAPDLRGISEQSLVVSGVQHQSTL |
| Gene ID - Mouse | ENSMUSG00000038224 |
| Gene ID - Rat | ENSRNOG00000003233 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SERPINF2 pAb (ATL-HPA001885) | |
| Datasheet | Anti SERPINF2 pAb (ATL-HPA001885) Datasheet (External Link) |
| Vendor Page | Anti SERPINF2 pAb (ATL-HPA001885) at Atlas Antibodies |
| Documents & Links for Anti SERPINF2 pAb (ATL-HPA001885) | |
| Datasheet | Anti SERPINF2 pAb (ATL-HPA001885) Datasheet (External Link) |
| Vendor Page | Anti SERPINF2 pAb (ATL-HPA001885) |
| Citations for Anti SERPINF2 pAb (ATL-HPA001885) – 1 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |