Anti SERPINA4 pAb (ATL-HPA003607)

Atlas Antibodies

Catalog No.: ATL-HPA003607-25

Protein Description: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4
Gene Name: SERPINA4
Alternative Gene Name: KAL, kallistatin, KLST, KST, PI4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066363: 47%, ENSRNOG00000009788: 53%
Entrez Gene ID: 5267
Uniprot ID: P29622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQE
• Gene Sequence: NLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQE
• Gene ID - Mouse: ENSMUSG00000066363
• Gene ID - Rat: ENSRNOG00000009788
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINA4 pAb (ATL-HPA003607) – 1 Found

Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.