Anti SERAC1 pAb (ATL-HPA025716 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025716-25

Protein Description: serine active site containing 1
Gene Name: SERAC1
Alternative Gene Name: FLJ14917
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015659: 85%, ENSRNOG00000017889: 84%
Entrez Gene ID: 84947
Uniprot ID: Q96JX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSHAARILANLDRETVQEKYQDGVYVLHPQYRTSQPIKA
• Gene Sequence: RVIGNMALNEHLHSSIVRSGWVSIMAEAMKSPHIMESSHAARILANLDRETVQEKYQDGVYVLHPQYRTSQPIKA
• Gene ID - Mouse: ENSMUSG00000015659
• Gene ID - Rat: ENSRNOG00000017889
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERAC1 pAb (ATL-HPA025716 w/enhanced validation) – 1 Found

Wortmann, Saskia B; Vaz, Frédéric M; Gardeitchik, Thatjana; Vissers, Lisenka E L M; Renkema, G Herma; Schuurs-Hoeijmakers, Janneke H M; Kulik, Wim; Lammens, Martin; Christin, Christin; Kluijtmans, Leo A J; Rodenburg, Richard J; Nijtmans, Leo G J; Grünewald, Anne; Klein, Christine; Gerhold, Joachim M; Kozicz, Tamas; van Hasselt, Peter M; Harakalova, Magdalena; Kloosterman, Wigard; Barić, Ivo; Pronicka, Ewa; Ucar, Sema Kalkan; Naess, Karin; Singhal, Kapil K; Krumina, Zita; Gilissen, Christian; van Bokhoven, Hans; Veltman, Joris A; Smeitink, Jan A M; Lefeber, Dirk J; Spelbrink, Johannes N; Wevers, Ron A; Morava, Eva; de Brouwer, Arjan P M. Mutations in the phospholipid remodeling gene SERAC1 impair mitochondrial function and intracellular cholesterol trafficking and cause dystonia and deafness. Nature Genetics. 2012;44(7):797-802.