Anti SERAC1 pAb (ATL-HPA025715)

Atlas Antibodies

Catalog No.: ATL-HPA025715-25

Protein Description: serine active site containing 1
Gene Name: SERAC1
Alternative Gene Name: FLJ14917
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015659: 89%, ENSRNOG00000017889: 89%
Entrez Gene ID: 84947
Uniprot ID: Q96JX3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMS
• Gene Sequence: KPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMERKSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMS
• Gene ID - Mouse: ENSMUSG00000015659
• Gene ID - Rat: ENSRNOG00000017889
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.