Anti SEPT9 pAb (ATL-HPA042564 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042564-25

Protein Description: septin 9
Gene Name: SEPT9
Alternative Gene Name: AF17q25, KIAA0991, MSF, MSF1, PNUTL4, SeptD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059248: 86%, ENSRNOG00000002807: 84%
Entrez Gene ID: 10801
Uniprot ID: Q9UHD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESA
• Gene Sequence: LGVKNSEPSARHVDSLSQRSPKASLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQESA
• Gene ID - Mouse: ENSMUSG00000059248
• Gene ID - Rat: ENSRNOG00000002807
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEPT9 pAb (ATL-HPA042564 w/enhanced validation) – 4 Found

Banko, Monika; Mucha-Kruczynska, Iwona; Weise, Christoph; Heyd, Florian; Ewers, Helge. A homozygous genome-edited Sept2-EGFP fibroblast cell line. Cytoskeleton (Hoboken, N.j.). 2019;76(1):73-82. 

Park, Hyun-Sook; Papanastasi, Eirini; Blanchard, Gabriela; Chiticariu, Elena; Bachmann, Daniel; Plomann, Markus; Morice-Picard, Fanny; Vabres, Pierre; Smahi, Asma; Huber, Marcel; Pich, Christine; Hohl, Daniel. ARP-T1-associated Bazex-Dupré-Christol syndrome is an inherited basal cell cancer with ciliary defects characteristic of ciliopathies. Communications Biology. 2021;4(1):544. 

Zhovmer, Alexander S; Manning, Alexis; Smith, Chynna; Hayes, James B; Burnette, Dylan T; Wang, Jian; Cartagena-Rivera, Alexander X; Dokholyan, Nikolay V; Singh, Rakesh K; Tabdanov, Erdem D. Mechanical Counterbalance of Kinesin and Dynein Motors in a Microtubular Network Regulates Cell Mechanics, 3D Architecture, and Mechanosensing. Acs Nano. 2021;15(11):17528-17548. 

Vadnjal, Neza; Nourreddine, Sami; Lavoie, Geneviève; Serres, Murielle; Roux, Philippe P; Paluch, Ewa K. Proteomic analysis of the actin cortex in interphase and mitosis. Journal Of Cell Science. 2022;135(16)