Anti SEPHS1 pAb (ATL-HPA037645)

Atlas Antibodies

Catalog No.:
ATL-HPA037645-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: selenophosphate synthetase 1
Gene Name: SEPHS1
Alternative Gene Name: SPS, SPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026662: 97%, ENSRNOG00000018125: 97%
Entrez Gene ID: 22929
Uniprot ID: P49903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MSTRESFNPESYELDKSFRLTRFTELKGTGCKVP
Gene Sequence MSTRESFNPESYELDKSFRLTRFTELKGTGCKVP
Gene ID - Mouse ENSMUSG00000026662
Gene ID - Rat ENSRNOG00000018125
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEPHS1 pAb (ATL-HPA037645)
Datasheet Anti SEPHS1 pAb (ATL-HPA037645) Datasheet (External Link)
Vendor Page Anti SEPHS1 pAb (ATL-HPA037645) at Atlas Antibodies

Documents & Links for Anti SEPHS1 pAb (ATL-HPA037645)
Datasheet Anti SEPHS1 pAb (ATL-HPA037645) Datasheet (External Link)
Vendor Page Anti SEPHS1 pAb (ATL-HPA037645)