Anti SEPHS1 pAb (ATL-HPA037645)

Atlas Antibodies

Catalog No.: ATL-HPA037645-25

Protein Description: selenophosphate synthetase 1
Gene Name: SEPHS1
Alternative Gene Name: SPS, SPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026662: 97%, ENSRNOG00000018125: 97%
Entrez Gene ID: 22929
Uniprot ID: P49903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSTRESFNPESYELDKSFRLTRFTELKGTGCKVP
• Gene Sequence: MSTRESFNPESYELDKSFRLTRFTELKGTGCKVP
• Gene ID - Mouse: ENSMUSG00000026662
• Gene ID - Rat: ENSRNOG00000018125
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.