Anti SEMA4G pAb (ATL-HPA038362)

Atlas Antibodies

Catalog No.:
ATL-HPA038362-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G
Gene Name: SEMA4G
Alternative Gene Name: FLJ20590, KIAA1619
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025207: 86%, ENSRNOG00000014650: 92%
Entrez Gene ID: 57715
Uniprot ID: Q9NTN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCH
Gene Sequence ATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSANDIGDGAHKEIHWEASPEMQSKCH
Gene ID - Mouse ENSMUSG00000025207
Gene ID - Rat ENSRNOG00000014650
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEMA4G pAb (ATL-HPA038362)
Datasheet Anti SEMA4G pAb (ATL-HPA038362) Datasheet (External Link)
Vendor Page Anti SEMA4G pAb (ATL-HPA038362) at Atlas Antibodies

Documents & Links for Anti SEMA4G pAb (ATL-HPA038362)
Datasheet Anti SEMA4G pAb (ATL-HPA038362) Datasheet (External Link)
Vendor Page Anti SEMA4G pAb (ATL-HPA038362)