Anti SEMA3D pAb (ATL-HPA037522)

Atlas Antibodies

Catalog No.:
ATL-HPA037522-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D
Gene Name: SEMA3D
Alternative Gene Name: coll-2, Sema-Z2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040254: 91%, ENSRNOG00000007202: 93%
Entrez Gene ID: 223117
Uniprot ID: O95025
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVG
Gene Sequence LYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESSQEGSTSDKTILSRVGRVCKNDVG
Gene ID - Mouse ENSMUSG00000040254
Gene ID - Rat ENSRNOG00000007202
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEMA3D pAb (ATL-HPA037522)
Datasheet Anti SEMA3D pAb (ATL-HPA037522) Datasheet (External Link)
Vendor Page Anti SEMA3D pAb (ATL-HPA037522) at Atlas Antibodies

Documents & Links for Anti SEMA3D pAb (ATL-HPA037522)
Datasheet Anti SEMA3D pAb (ATL-HPA037522) Datasheet (External Link)
Vendor Page Anti SEMA3D pAb (ATL-HPA037522)