Anti SECISBP2L pAb (ATL-HPA039875)

Atlas Antibodies

Catalog No.: ATL-HPA039875-25

Protein Description: SECIS binding protein 2-like
Gene Name: SECISBP2L
Alternative Gene Name: KIAA0256
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035093: 73%, ENSRNOG00000008629: 76%
Entrez Gene ID: 9728
Uniprot ID: Q93073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISEVNEKEYETNWRNMVETSDGLEASENEKEVSCKHSTSEKPSKLPFDTPAIGKQPSLVATGSTTSATSAGKSTASDK
• Gene Sequence: EEALKNVKKVPHHMGHSRNPSAASAISFCSVISEPISEVNEKEYETNWRNMVETSDGLEASENEKEVSCKHSTSEKPSKLPFDTPAIGKQPSLVATGSTTSATSAGKSTASDK
• Gene ID - Mouse: ENSMUSG00000035093
• Gene ID - Rat: ENSRNOG00000008629
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SECISBP2L pAb (ATL-HPA039875) – 1 Found

Dai, Zhong-Min; Guo, Wei; Yu, Dan; Zhu, Xiao-Jing; Sun, Shuhui; Huang, Hao; Jiang, Min; Xie, Binghua; Zhang, Zunyi; Qiu, Mengsheng. SECISBP2L-Mediated Selenoprotein Synthesis Is Essential for Autonomous Regulation of Oligodendrocyte Differentiation. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2022;42(30):5860-5869.