Anti SEC31B pAb (ATL-HPA035882)

Atlas Antibodies

Catalog No.: ATL-HPA035882-25

Protein Description: SEC31 homolog B (S. cerevisiae)
Gene Name: SEC31B
Alternative Gene Name: DKFZP434M183, SEC31B-1, SEC31L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051984: 62%, ENSRNOG00000025781: 61%
Entrez Gene ID: 25956
Uniprot ID: Q9NQW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSSPAMPLAPSHPSPYQGPRTQNISDYRA
• Gene Sequence: HAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSSPAMPLAPSHPSPYQGPRTQNISDYRA
• Gene ID - Mouse: ENSMUSG00000051984
• Gene ID - Rat: ENSRNOG00000025781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.