Anti SEC23IP pAb (ATL-HPA043305 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043305-25

Protein Description: SEC23 interacting protein
Gene Name: SEC23IP
Alternative Gene Name: p125
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055319: 72%, ENSRNOG00000020411: 73%
Entrez Gene ID: 11196
Uniprot ID: Q9Y6Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM
• Gene Sequence: CPGPLAVANGVVKQLHFQEKQMPEEPKLTLDESYDLVVENEEVLTLQETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEM
• Gene ID - Mouse: ENSMUSG00000055319
• Gene ID - Rat: ENSRNOG00000020411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEC23IP pAb (ATL-HPA043305 w/enhanced validation) – 1 Found

Liu, Jennifer Y; Lin, Yu-Hsiu Tony; Leidal, Andrew M; Huang, Hector H; Ye, Jordan; Wiita, Arun P; Debnath, Jayanta. GRASP55 restricts early-stage autophagy and regulates spatial organization of the early secretory network. Biology Open. 2021;10(10)