Anti SDR16C5 pAb (ATL-HPA025224 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025224-25

Protein Description: short chain dehydrogenase/reductase family 16C, member 5
Gene Name: SDR16C5
Alternative Gene Name: RDH-E2, RDHE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028236: 70%, ENSRNOG00000008871: 76%
Entrez Gene ID: 195814
Uniprot ID: Q8N3Y7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL
• Gene Sequence: CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL
• Gene ID - Mouse: ENSMUSG00000028236
• Gene ID - Rat: ENSRNOG00000008871
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SDR16C5 pAb (ATL-HPA025224 w/enhanced validation) – 1 Found

Baras, Alexander S; Gandhi, Nilay; Munari, Enrico; Faraj, Sheila; Shultz, Luciana; Marchionni, Luigi; Schoenberg, Mark; Hahn, Noah; Hoque, Mohammad Obaidul; Berman, David; Bivalacqua, Trinity J; Netto, George. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. Plos One. 10(7):e0131245.