Anti SDHAF2 pAb (ATL-HPA039732)

Atlas Antibodies

Catalog No.:
ATL-HPA039732-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: succinate dehydrogenase complex assembly factor 2
Gene Name: SDHAF2
Alternative Gene Name: C11orf79, FLJ20487, PGL2, SDH5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024668: 98%, ENSRNOG00000020646: 100%
Entrez Gene ID: 54949
Uniprot ID: Q9NX18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILL
Gene Sequence LSPLLSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESRKRGMLENCILL
Gene ID - Mouse ENSMUSG00000024668
Gene ID - Rat ENSRNOG00000020646
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SDHAF2 pAb (ATL-HPA039732)
Datasheet Anti SDHAF2 pAb (ATL-HPA039732) Datasheet (External Link)
Vendor Page Anti SDHAF2 pAb (ATL-HPA039732) at Atlas Antibodies

Documents & Links for Anti SDHAF2 pAb (ATL-HPA039732)
Datasheet Anti SDHAF2 pAb (ATL-HPA039732) Datasheet (External Link)
Vendor Page Anti SDHAF2 pAb (ATL-HPA039732)