Anti SDF4 pAb (ATL-HPA011249 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011249-25

Protein Description: stromal cell derived factor 4
Gene Name: SDF4
Alternative Gene Name: Cab45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029076: 79%, ENSRNOG00000019981: 79%
Entrez Gene ID: 51150
Uniprot ID: Q9BRK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTAEEPQSYMDLRRAPPLSNN
• Gene Sequence: DQDGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTAEEPQSYMDLRRAPPLSNN
• Gene ID - Mouse: ENSMUSG00000029076
• Gene ID - Rat: ENSRNOG00000019981
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SDF4 pAb (ATL-HPA011249 w/enhanced validation) – 1 Found

Khakurel, Amrita; Kudlyk, Tetyana; Pokrovskaya, Irina; D'Souza, Zinia; Lupashin, Vladimir V. GARP dysfunction results in COPI displacement, depletion of Golgi v-SNAREs and calcium homeostasis proteins. Frontiers In Cell And Developmental Biology. 10( 36578782):1066504.