Anti SDCCAG3 pAb (ATL-HPA029303)

Atlas Antibodies

Catalog No.: ATL-HPA029303-25

Protein Description: serologically defined colon cancer antigen 3
Gene Name: SDCCAG3
Alternative Gene Name: NY-CO-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026927: 89%, ENSRNOG00000018876: 90%
Entrez Gene ID: 10807
Uniprot ID: Q96C92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEVKDEEE
• Gene Sequence: NEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILKSIDRISEVKDEEE
• Gene ID - Mouse: ENSMUSG00000026927
• Gene ID - Rat: ENSRNOG00000018876
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SDCCAG3 pAb (ATL-HPA029303) – 2 Found

Sharma, Shruti; Carmona, Antonio; Skowronek, Agnieszka; Yu, Fangyan; Collins, Mark O; Naik, Sindhu; Murzeau, Claire M; Tseng, Pei-Li; Erdmann, Kai S. Apoptotic signalling targets the post-endocytic sorting machinery of the death receptor Fas/CD95. Nature Communications. 2019;10(1):3105. 

Yu, Fangyan; Sharma, Shruti; Skowronek, Agnieszka; Erdmann, Kai Sven. The serologically defined colon cancer antigen-3 (SDCCAG3) is involved in the regulation of ciliogenesis. Scientific Reports. 2016;6( 27767179):35399.