Anti SCTR pAb (ATL-HPA007269)

Atlas Antibodies

Catalog No.: ATL-HPA007269-25

Protein Description: secretin receptor
Gene Name: SCTR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026387: 66%, ENSRNOG00000049766: 70%
Entrez Gene ID: 6344
Uniprot ID: P47872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL
• Gene Sequence: CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL
• Gene ID - Mouse: ENSMUSG00000026387
• Gene ID - Rat: ENSRNOG00000049766
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCTR pAb (ATL-HPA007269) – 2 Found

Procino, Giuseppe; Milano, Serena; Carmosino, Monica; Barbieri, Claudia; Nicoletti, Maria C; Li, Jian H; Wess, Jürgen; Svelto, Maria. Combination of secretin and fluvastatin ameliorates the polyuria associated with X-linked nephrogenic diabetes insipidus in mice. Kidney International. 2014;86(1):127-38. 

Klussmeier, Anja; Aurich, Stefan; Niederstadt, Lars; Wiedenmann, Bertram; Grötzinger, Carsten. Secretin Receptor as a Target in Gastrointestinal Cancer: Expression Analysis and Ligand Development. Biomedicines. 2022;10(3)