Anti SCIN pAb (ATL-HPA024264 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024264-25

Protein Description: scinderin
Gene Name: SCIN
Alternative Gene Name: adseverin, KIAA1905
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002565: 89%, ENSRNOG00000004498: 90%
Entrez Gene ID: 85477
Uniprot ID: Q9Y6U3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNK
• Gene Sequence: RNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNK
• Gene ID - Mouse: ENSMUSG00000002565
• Gene ID - Rat: ENSRNOG00000004498
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCIN pAb (ATL-HPA024264 w/enhanced validation) – 1 Found

Zhou, Bin; Chen, Tian-Wei; Jiang, Ya-Bo; Wei, Xu-Biao; Lu, Chong-De; Li, Jing-Jing; Xie, Dong; Cheng, Shu-Qun. Scinderin suppresses cell proliferation and predicts the poor prognosis of hepatocellular carcinoma. Oncology Letters. 2020;19(3):2011-2020.