Anti SCG2 pAb (ATL-HPA011893 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011893-25

Protein Description: secretogranin II
Gene Name: SCG2
Alternative Gene Name: CHGC, SgII, SN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050711: 72%, ENSRNOG00000015055: 74%
Entrez Gene ID: 7857
Uniprot ID: P13521
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTP
• Gene Sequence: NLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPKAAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEEEQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTP
• Gene ID - Mouse: ENSMUSG00000050711
• Gene ID - Rat: ENSRNOG00000015055
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCG2 pAb (ATL-HPA011893 w/enhanced validation) – 2 Found

Alrawashdeh, Wasfi; Jones, Richard; Dumartin, Laurent; Radon, Tomasz P; Cutillas, Pedro R; Feakins, Roger M; Dmitrovic, Branko; Demir, Ihsan Ekin; Ceyhan, Guralp O; Crnogorac-Jurcevic, Tatjana. Perineural invasion in pancreatic cancer: proteomic analysis and in vitro modelling. Molecular Oncology. 2019;13(5):1075-1091. 

Sainero-Alcolado, Lourdes; Mushtaq, Muhammad; Liaño-Pons, Judit; Rodriguez-Garcia, Aida; Yuan, Ye; Liu, Tong; Ruiz-Pérez, María Victoria; Schlisio, Susanne; Bedoya-Reina, Oscar; Arsenian-Henriksson, Marie. Expression and activation of nuclear hormone receptors result in neuronal differentiation and favorable prognosis in neuroblastoma. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):226.