Anti SCEL pAb (ATL-HPA039737 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039737-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sciellin
Gene Name: SCEL
Alternative Gene Name: FLJ21667, MGC22531
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022123: 75%, ENSRNOG00000024237: 78%
Entrez Gene ID: 8796
Uniprot ID: O95171
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYS
Gene Sequence KMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYS
Gene ID - Mouse ENSMUSG00000022123
Gene ID - Rat ENSRNOG00000024237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCEL pAb (ATL-HPA039737 w/enhanced validation)
Datasheet Anti SCEL pAb (ATL-HPA039737 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCEL pAb (ATL-HPA039737 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SCEL pAb (ATL-HPA039737 w/enhanced validation)
Datasheet Anti SCEL pAb (ATL-HPA039737 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SCEL pAb (ATL-HPA039737 w/enhanced validation)