Anti SCD pAb (ATL-HPA012107)

Atlas Antibodies

Catalog No.: ATL-HPA012107-25

Protein Description: stearoyl-CoA desaturase (delta-9-desaturase)
Gene Name: SCD
Alternative Gene Name: FADS5, SCDOS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025202: 71%, ENSRNOG00000013552: 68%
Entrez Gene ID: 6319
Uniprot ID: O00767
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY
• Gene Sequence: ISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEY
• Gene ID - Mouse: ENSMUSG00000025202
• Gene ID - Rat: ENSRNOG00000013552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCD pAb (ATL-HPA012107) – 3 Found

von Roemeling, Christina A; Marlow, Laura A; Pinkerton, Anthony B; Crist, Angela; Miller, James; Tun, Han W; Smallridge, Robert C; Copland, John A. Aberrant lipid metabolism in anaplastic thyroid carcinoma reveals stearoyl CoA desaturase 1 as a novel therapeutic target. The Journal Of Clinical Endocrinology And Metabolism. 2015;100(5):E697-709. 

von Roemeling, Christina A; Caulfield, Thomas R; Marlow, Laura; Bok, Ilah; Wen, Jiang; Miller, James L; Hughes, Robert; Hazlehurst, Lori; Pinkerton, Anthony B; Radisky, Derek C; Tun, Han W; Kim, Yon Son Betty; Lane, Amy L; Copland, John A. Accelerated bottom-up drug design platform enables the discovery of novel stearoyl-CoA desaturase 1 inhibitors for cancer therapy. Oncotarget. 2018;9(1):3-20. 

Li, Gang; Li, Xin; Mahmud, Iqbal; Ysaguirre, Jazmin; Fekry, Baharan; Wang, Shuyue; Wei, Bo; Eckel-Mahan, Kristin L; Lorenzi, Philip L; Lehner, Richard; Sun, Kai. Interfering with lipid metabolism through targeting CES1 sensitizes hepatocellular carcinoma for chemotherapy. Jci Insight. 2023;8(2)