Anti SCARF2 pAb (ATL-HPA035079)

Atlas Antibodies

Catalog No.: ATL-HPA035079-25

Protein Description: scavenger receptor class F, member 2
Gene Name: SCARF2
Alternative Gene Name: HUMZD58C02, SREC-II, SREC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012017: 86%, ENSRNOG00000000288: 89%
Entrez Gene ID: 91179
Uniprot ID: Q96GP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP
• Gene Sequence: HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP
• Gene ID - Mouse: ENSMUSG00000012017
• Gene ID - Rat: ENSRNOG00000000288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCARF2 pAb (ATL-HPA035079) – 1 Found

Patten, Daniel A; Kamarajah, Sivesh K; Rose, Joanne M; Tickle, Joseph; Shepherd, Emma L; Adams, David H; Weston, Chris J; Shetty, Shishir. SCARF-1 promotes adhesion of CD4(+) T cells to human hepatic sinusoidal endothelium under conditions of shear stress. Scientific Reports. 2017;7(1):17600.