Anti SCARA5 pAb (ATL-HPA024661)

Atlas Antibodies

Catalog No.: ATL-HPA024661-25

Protein Description: scavenger receptor class A, member 5
Gene Name: SCARA5
Alternative Gene Name: FLJ23907, MGC45780, NET33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022032: 94%, ENSRNOG00000014398: 94%
Entrez Gene ID: 286133
Uniprot ID: Q6ZMJ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLE
• Gene Sequence: PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLE
• Gene ID - Mouse: ENSMUSG00000022032
• Gene ID - Rat: ENSRNOG00000014398
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCARA5 pAb (ATL-HPA024661) – 1 Found

Swystun, Laura L; Ogiwara, Kenichi; Lai, Jesse D; Ojala, Juha R M; Rawley, Orla; Lassalle, Fanny; Notley, Colleen; Rengby, Olle; Michels, Alison; Nesbitt, Kate; Tryggvason, Karl; Lillicrap, David. The scavenger receptor SCARA5 is an endocytic receptor for von Willebrand factor expressed by littoral cells in the human spleen. Journal Of Thrombosis And Haemostasis : Jth. 2019;17(8):1384-1396.