Anti SCAI pAb (ATL-HPA020632)

Atlas Antibodies

Catalog No.: ATL-HPA020632-25

Protein Description: suppressor of cancer cell invasion
Gene Name: SCAI
Alternative Gene Name: C9orf126, FLJ36664, NET40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035236: 98%, ENSRNOG00000025278: 99%
Entrez Gene ID: 286205
Uniprot ID: Q8N9R8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFT
• Gene Sequence: LLYKPTFSQLYTFLAASFKELPANSVLLIYLSATGVFPTGRSDSEGPYDFGGVLTNSNRDIINGDAIHKRNQSHKEMHCLHPGDLYPFTRKPLFIIVDSSNSVAYKNFT
• Gene ID - Mouse: ENSMUSG00000035236
• Gene ID - Rat: ENSRNOG00000025278
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.