Anti SAT2 pAb (ATL-HPA022136 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA022136-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: spermidine/spermine N1-acetyltransferase family member 2
Gene Name: SAT2
Alternative Gene Name: SSAT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069835: 79%, ENSRNOG00000011714: 78%
Entrez Gene ID: 112483
Uniprot ID: Q96F10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Gene Sequence IYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK
Gene ID - Mouse ENSMUSG00000069835
Gene ID - Rat ENSRNOG00000011714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SAT2 pAb (ATL-HPA022136 w/enhanced validation)
Datasheet Anti SAT2 pAb (ATL-HPA022136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SAT2 pAb (ATL-HPA022136 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SAT2 pAb (ATL-HPA022136 w/enhanced validation)
Datasheet Anti SAT2 pAb (ATL-HPA022136 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SAT2 pAb (ATL-HPA022136 w/enhanced validation)