Anti SASH3 pAb (ATL-HPA001085 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001085-100

Protein Description: SAM and SH3 domain containing 3
Gene Name: SASH3
Alternative Gene Name: 753P9, CXorf9, HACS2, SH3D6C, SLY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031101: 99%, ENSRNOG00000004409: 97%
Entrez Gene ID: 54440
Uniprot ID: O75995
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL
• Gene Sequence: PKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRDDAELAGTEEQLQGLSL
• Gene ID - Mouse: ENSMUSG00000031101
• Gene ID - Rat: ENSRNOG00000004409
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.