Anti SART3 pAb (ATL-HPA044322)

Atlas Antibodies

Catalog No.: ATL-HPA044322-25

Protein Description: squamous cell carcinoma antigen recognized by T cells 3
Gene Name: SART3
Alternative Gene Name: KIAA0156, p110, RP11-13G14, TIP110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018974: 87%, ENSRNOG00000000702: 87%
Entrez Gene ID: 9733
Uniprot ID: Q15020
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIE
• Gene Sequence: PWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIE
• Gene ID - Mouse: ENSMUSG00000018974
• Gene ID - Rat: ENSRNOG00000000702
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.