Anti SART1 pAb (ATL-HPA031189)

Atlas Antibodies

Catalog No.:
ATL-HPA031189-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: squamous cell carcinoma antigen recognized by T cells
Gene Name: SART1
Alternative Gene Name: Ara1, SNRNP110, Snu66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039148: 85%, ENSRNOG00000020475: 83%
Entrez Gene ID: 9092
Uniprot ID: O43290
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKG
Gene Sequence RRVKKIRKKEKEVVVRADDLLPLGDQTQDGDFGSRLRGRGRRRVSEVEEEKEPVPQPLPSDDTRVENMDISDEEEGGAPPPGSPQVLEEDEAELELQKQLEKG
Gene ID - Mouse ENSMUSG00000039148
Gene ID - Rat ENSRNOG00000020475
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SART1 pAb (ATL-HPA031189)
Datasheet Anti SART1 pAb (ATL-HPA031189) Datasheet (External Link)
Vendor Page Anti SART1 pAb (ATL-HPA031189) at Atlas Antibodies

Documents & Links for Anti SART1 pAb (ATL-HPA031189)
Datasheet Anti SART1 pAb (ATL-HPA031189) Datasheet (External Link)
Vendor Page Anti SART1 pAb (ATL-HPA031189)