Anti SART1 pAb (ATL-HPA031188)

Atlas Antibodies

Catalog No.: ATL-HPA031188-25

Protein Description: squamous cell carcinoma antigen recognized by T cells
Gene Name: SART1
Alternative Gene Name: Ara1, SNRNP110, Snu66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039148: 91%, ENSRNOG00000020475: 92%
Entrez Gene ID: 9092
Uniprot ID: O43290
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER
• Gene Sequence: TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER
• Gene ID - Mouse: ENSMUSG00000039148
• Gene ID - Rat: ENSRNOG00000020475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.