Anti SART1 pAb (ATL-HPA031188)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031188-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SART1
Alternative Gene Name: Ara1, SNRNP110, Snu66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039148: 91%, ENSRNOG00000020475: 92%
Entrez Gene ID: 9092
Uniprot ID: O43290
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER |
| Gene Sequence | TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER |
| Gene ID - Mouse | ENSMUSG00000039148 |
| Gene ID - Rat | ENSRNOG00000020475 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SART1 pAb (ATL-HPA031188) | |
| Datasheet | Anti SART1 pAb (ATL-HPA031188) Datasheet (External Link) |
| Vendor Page | Anti SART1 pAb (ATL-HPA031188) at Atlas Antibodies |
| Documents & Links for Anti SART1 pAb (ATL-HPA031188) | |
| Datasheet | Anti SART1 pAb (ATL-HPA031188) Datasheet (External Link) |
| Vendor Page | Anti SART1 pAb (ATL-HPA031188) |