Anti SARNP pAb (ATL-HPA030902)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030902-100
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/640x640/products/87742/160019/atl-hpa030902_anti-sarnp-pab-atl-hpa030902_41658__91519.1681111553.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue")
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: SARNP
Alternative Gene Name: CIP29, Hcc-1, THO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078427: 99%, ENSRNOG00000030520: 99%
Entrez Gene ID: 84324
Uniprot ID: P82979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA |
| Gene Sequence | SSDNKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA |
| Gene ID - Mouse | ENSMUSG00000078427 |
| Gene ID - Rat | ENSRNOG00000030520 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SARNP pAb (ATL-HPA030902) | |
| Datasheet | Anti SARNP pAb (ATL-HPA030902) Datasheet (External Link) |
| Vendor Page | Anti SARNP pAb (ATL-HPA030902) at Atlas Antibodies |
| Documents & Links for Anti SARNP pAb (ATL-HPA030902) | |
| Datasheet | Anti SARNP pAb (ATL-HPA030902) Datasheet (External Link) |
| Vendor Page | Anti SARNP pAb (ATL-HPA030902) |
| Citations for Anti SARNP pAb (ATL-HPA030902) – 1 Found |
| Boehringer, Ashley; Garcia-Mansfield, Krystine; Singh, Gurkaran; Bakkar, Nadine; Pirrotte, Patrick; Bowser, Robert. ALS Associated Mutations in Matrin 3 Alter Protein-Protein Interactions and Impede mRNA Nuclear Export. Scientific Reports. 2017;7(1):14529. PubMed |