Anti S100PBP pAb (ATL-HPA027242)

Atlas Antibodies

Catalog No.:
ATL-HPA027242-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: S100P binding protein
Gene Name: S100PBP
Alternative Gene Name: FLJ12903, S100PBPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040928: 60%, ENSRNOG00000007099: 62%
Entrez Gene ID: 64766
Uniprot ID: Q96BU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRVPSEQSSGTSLLPKDGAPFSWDSLDEDGLDDSLLELSEGEEDDGDVNYTEEEIDALLKEDDPSYEQSSGEDDGGHVEKGERGSQILLDTP
Gene Sequence SRVPSEQSSGTSLLPKDGAPFSWDSLDEDGLDDSLLELSEGEEDDGDVNYTEEEIDALLKEDDPSYEQSSGEDDGGHVEKGERGSQILLDTP
Gene ID - Mouse ENSMUSG00000040928
Gene ID - Rat ENSRNOG00000007099
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti S100PBP pAb (ATL-HPA027242)
Datasheet Anti S100PBP pAb (ATL-HPA027242) Datasheet (External Link)
Vendor Page Anti S100PBP pAb (ATL-HPA027242) at Atlas Antibodies

Documents & Links for Anti S100PBP pAb (ATL-HPA027242)
Datasheet Anti S100PBP pAb (ATL-HPA027242) Datasheet (External Link)
Vendor Page Anti S100PBP pAb (ATL-HPA027242)