Anti RXFP3 pAb (ATL-HPA027833)

Atlas Antibodies

Catalog No.:
ATL-HPA027833-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: relaxin/insulin-like family peptide receptor 3
Gene Name: RXFP3
Alternative Gene Name: GPCR135, RLN3R1, RXFPR3, SALPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060735: 73%, ENSRNOG00000023126: 71%
Entrez Gene ID: 51289
Uniprot ID: Q9NSD7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG
Gene Sequence MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDG
Gene ID - Mouse ENSMUSG00000060735
Gene ID - Rat ENSRNOG00000023126
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RXFP3 pAb (ATL-HPA027833)
Datasheet Anti RXFP3 pAb (ATL-HPA027833) Datasheet (External Link)
Vendor Page Anti RXFP3 pAb (ATL-HPA027833) at Atlas Antibodies

Documents & Links for Anti RXFP3 pAb (ATL-HPA027833)
Datasheet Anti RXFP3 pAb (ATL-HPA027833) Datasheet (External Link)
Vendor Page Anti RXFP3 pAb (ATL-HPA027833)