Anti RUSC2 pAb (ATL-HPA021297)

Atlas Antibodies

Catalog No.: ATL-HPA021297-25

Protein Description: RUN and SH3 domain containing 2
Gene Name: RUSC2
Alternative Gene Name: KIAA0375
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035969: 90%, ENSRNOG00000045843: 93%
Entrez Gene ID: 9853
Uniprot ID: Q8N2Y8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPSPFESKMSYESHHPESGGREGGYGCPHASSPELDANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSITSCSEEHTKISP
• Gene Sequence: QPSPFESKMSYESHHPESGGREGGYGCPHASSPELDANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSITSCSEEHTKISP
• Gene ID - Mouse: ENSMUSG00000035969
• Gene ID - Rat: ENSRNOG00000045843
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.