Anti RTP2 pAb (ATL-HPA026875)

Atlas Antibodies

Catalog No.: ATL-HPA026875-25

Protein Description: receptor (chemosensory) transporter protein 2
Gene Name: RTP2
Alternative Gene Name: MGC78665, Z3CXXC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047531: 73%, ENSRNOG00000021992: 72%
Entrez Gene ID: 344892
Uniprot ID: Q5QGT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRIHVASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNF
• Gene Sequence: YRIHVASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNF
• Gene ID - Mouse: ENSMUSG00000047531
• Gene ID - Rat: ENSRNOG00000021992
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.