Anti RTN4IP1 pAb (ATL-HPA036357)

Atlas Antibodies

Catalog No.: ATL-HPA036357-25

Protein Description: reticulon 4 interacting protein 1
Gene Name: RTN4IP1
Alternative Gene Name: NIMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019864: 91%, ENSRNOG00000000279: 91%
Entrez Gene ID: 84816
Uniprot ID: Q8WWV3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK
• Gene Sequence: TLVTPFLLNMDRLGIADGMLQTGVTVGSKALKHFWKGVHYRWAFFMASGPCLDDIAELVDAGKIRPVIEQTFPFSKVPEAFLKVERGHARGK
• Gene ID - Mouse: ENSMUSG00000019864
• Gene ID - Rat: ENSRNOG00000000279
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.