Anti RTN2 pAb (ATL-HPA034948)

Atlas Antibodies

Catalog No.:
ATL-HPA034948-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: reticulon 2
Gene Name: RTN2
Alternative Gene Name: NSP2, NSPL1, SPG12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040703: 27%, ENSRNOG00000055525: 26%
Entrez Gene ID: 6253
Uniprot ID: O75298
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TAMEWLKTSLLLAVYKTVPILELSPPLWTAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKV
Gene Sequence TAMEWLKTSLLLAVYKTVPILELSPPLWTAIGWVQRGPTPPTPVLRVLLKWAKSPRSSGVPSLSLGADMGSKV
Gene ID - Mouse ENSMUSG00000040703
Gene ID - Rat ENSRNOG00000055525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RTN2 pAb (ATL-HPA034948)
Datasheet Anti RTN2 pAb (ATL-HPA034948) Datasheet (External Link)
Vendor Page Anti RTN2 pAb (ATL-HPA034948) at Atlas Antibodies

Documents & Links for Anti RTN2 pAb (ATL-HPA034948)
Datasheet Anti RTN2 pAb (ATL-HPA034948) Datasheet (External Link)
Vendor Page Anti RTN2 pAb (ATL-HPA034948)